PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_5337_iso_8
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family TALE
Protein Properties Length: 702aa    MW: 76969.3 Da    PI: 5.8005
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_5337_iso_8genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.33.1e-094354721954
                                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                                          Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  cra_locus_5337_iso_8_len_2810_ver_3 435 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 472
                                          664459******************************88 PP

2BELL118.43.4e-38297368172
                                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                                          e+q+lq+k +kL  +l+eV++rYkqy++q+q+v+ssF+ +ag g++kpYt+lAl++iSrhFrcL+dai+eq+
  cra_locus_5337_iso_8_len_2810_ver_3 297 EKQDLQNKMTKLSAMLDEVERRYKQYYHQMQIVVSSFDGIAGPGASKPYTALALQTISRHFRCLRDAISEQV 368
                                          6899******************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.1E-59217366IPR006563POX domain
PfamPF075266.3E-49223365IPR006563POX domain
PROSITE profilePS5007112.115413476IPR001356Homeobox domain
SMARTSM003891.6E-9416480IPR001356Homeobox domain
CDDcd000868.14E-13416477No hitNo description
SuperFamilySSF466892.95E-17417483IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-28419482IPR009057Homeodomain-like
PfamPF059204.8E-18433472IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 702 aa     Download sequence    Send to blast
MASFFPSPEN QRDASTILHL REPLPGSYSE GQVLPGNMMM YMNYASPSGE YSGTLPGNGG  60
QQQNSCIAIM PGASDSNPSQ QEILSDLGGS RVGEHDLNEW RDGRTSMLLM HPAEAAASVF  120
QCPQNLQGQG LSLTLSTHVP SGFRMPSFHC RTPDQGFSSF LSGTPSISNE DTGRNGTFGN  180
NNSSPNKQSR ISEFVPPGFL GSNSNPVRAD TSPYGVSGIA RAIPNSKYLK AAQQLLDEVV  240
NVKKALKEQS SKNKLVKDSK NADGGTKNGA LEPAGAGSSS NLEESSTNSP VELSAAEKQD  300
LQNKMTKLSA MLDEVERRYK QYYHQMQIVV SSFDGIAGPG ASKPYTALAL QTISRHFRCL  360
RDAISEQVQV TRKSLGDQDA SENSKGVGIS RLRYVDQQIR QQRALQQLGM MQQHAWRPQR  420
GLPETSVSIL RAWLFEHFLH PYPKDSDKIM LARQTGLTRS QVSNWFINAR VRLWKPMVEE  480
MYKEEIGDGE MDINSPSELA TKATNSEAKD SEDRAAEDLQ QSTTSTPTER CSTGQFFESR  540
SDHFADVELM EPNIDQAYQN LNHTETENEY GLGKSRSGSR RPEMNDCSFL PETTIVHQSN  600
EGSHRLMAAA AAYHMSELER FENGNGGVSL TLGLQQCEGT NVAMSIGTHQ GYVAMRGDTI  660
YTTAAAASMV SEGTDQFDIM DTGNHVSHQR FGSSHLLHDF VA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A8e-17422479158Homeobox protein Meis1
4xrs_B8e-17422479158Homeobox protein Meis1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015892487.10.0PREDICTED: BEL1-like homeodomain protein 6
TrEMBLA0A068TL140.0A0A068TL14_COFCA; Uncharacterized protein
STRINGVIT_03s0038g00050.t010.0(Vitis vinifera)